DRP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84822

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DRP2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of DRP2. Peptide sequence: LEEPHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DRP2 Antibody - BSA Free

Western Blot: DRP2 Antibody [NBP2-84822]

Western Blot: DRP2 Antibody [NBP2-84822]

Western Blot: DRP2 Antibody [NBP2-84822] - WB Suggested Anti-DRP2 Antibody. Titration: 1.0 ug/ml. Positive Control: 721_B Whole Cell

Applications for DRP2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DRP2

Dystrophin, utrophin and dystrophin-related protein 2 (DRP2) are Actin-binding proteins that are involved in anchoring the cytoskeleton to the plasma membrane. Dystrophin is the protein product of the Duchenne/Becker muscular dystrophy gene. Dystrophin is expressed in muscle and brain tissues, where it is localized to the inner surface of the plasma membrane. Evidence suggests that the upregulation of utrophin (also known as DRP1) can reduce the dystrophic pathology. DRP2 is principally expressed in the brain and spinal cord. Analysis of DRP2 expression in rat brain on SDS-PAGE reveals a characteristic quartet of bands from 100-120 kDa. DRP2 exhibits a punctate staining pattern of rat neuronal dendrites and in neuropil. DRP2 forms a complex with dystroglycan at the surface of myelin-forming Schwann cells and may play a role in the terminal stages of myelinogenesis in the peripheral nervous system. The gene encoding human DRP2 maps to chromosome Xq22.

Alternate Names

dystrophin related protein 2, dystrophin-related protein 2, MGC133255

Gene Symbol

DRP2

Additional DRP2 Products

Product Documents for DRP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DRP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DRP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DRP2 Antibody - BSA Free and earn rewards!

Have you used DRP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies