DUSP13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86620

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all DUSP13 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human DUSP13. Peptide sequence: DRRLKASSTNCPSEKCTAWARYSHRMDSLQKQDLRRPKIHGAVQASPYQP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DUSP13 Antibody - BSA Free

Western Blot: DUSP13 Antibody [NBP2-86620]

Western Blot: DUSP13 Antibody [NBP2-86620]

Western Blot: DUSP13 Antibody [NBP2-86620] - WB Suggested Anti-DUSP13 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung

Applications for DUSP13 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP13

Official Gene Symbol: DUSP13 Gen Bank Accession Number: NP_001007274 Gene ID: 51207 (Human) Gene Map Locus: 10q22.2 (Human) DUSP13, a novel DSP, is a member of highly conserved Protein-tyrosine phosphatase super family. Members of this family cooperate with protein kinases and play a vital role in cell cycle regulation. DUSP13 consists of a conserved catalytic domain and is expressed specifically in the testis and skeletal muscle. Based on mRNA localization and expression studies during development, DUSP13 is suggested to be expressed as 3 isoforms due to alternative splicing. Reports suggest DUSP13 might be involved in the regulation of meiosis and differentiation of testicular germ cells during spermatogenesis.

Alternate Names

Branching-enzyme interacting DSP, dual specificity phosphatase 13, Dual specificity phosphatase SKRP4, dual specificity protein phosphatase 13, dual specificity protein phosphatase 13 isoform MDSP, dual-specificity phosphatase SKRP4, DUSP13A, DUSP13B, EC 3.1.3.16, EC 3.1.3.48, FLJ32450, MDSPbranching-enzyme interacting dual-specificity protein phosphatase, Muscle-restricted DSP, Testis- and skeletal-muscle-specific DSP, TMDPBEDPSKRP4

Gene Symbol

DUSP13B

Additional DUSP13 Products

Product Documents for DUSP13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DUSP13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DUSP13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DUSP13 Antibody - BSA Free and earn rewards!

Have you used DUSP13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies