Dystrobrevin alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88808

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Dystrobrevin alpha. Peptide sequence: DMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Dystrobrevin alpha Antibody - BSA Free

Western Blot: Dystrobrevin alpha Antibody [NBP2-88808]

Western Blot: Dystrobrevin alpha Antibody [NBP2-88808]

Western Blot: Dystrobrevin alpha Antibody [NBP2-88808] - Host: Rabbit. Target Name: DTNA. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Dystrobrevin alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dystrobrevin alpha

Dystrobrevin alpha is encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

Alpha-dystrobrevin, D18S892EDTN, DRP3FLJ96209, DTN-1, DTN-2, DTN-3, DTN-A, dystrobrevin alpha, dystrobrevin, alpha, Dystrophin-related protein 3, LVNC1

Gene Symbol

DTNA

Additional Dystrobrevin alpha Products

Product Documents for Dystrobrevin alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dystrobrevin alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dystrobrevin alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dystrobrevin alpha Antibody - BSA Free and earn rewards!

Have you used Dystrobrevin alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...