E2F3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80295

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human E2F3. Peptide sequence LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for E2F3 Antibody - BSA Free

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Mouse. Target Name: E2F3. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml
E2F3 Antibody

Western Blot: Rabbit Polyclonal E2F3 Antibody [NBP1-80295]

Western Blot: Rabbit Polyclonal E2F3 Antibody [NBP1-80295] - E2F3 detection in mouse cortex sample. 1:2000 dilution at 4 degrees overnight to detect endogenous E2F3 from mouse cortex samples (10 ug). Image from a verified customer review.

Applications for E2F3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 5 using NBP1-80295 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F3

E2F3 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Alternate Names

DKFZp686C18211, E2F transcription factor 3, E2F-3, KIAA0075, MGC104598, transcription factor E2F3

Entrez Gene IDs

1871 (Human)

Gene Symbol

E2F3

Additional E2F3 Products

Product Documents for E2F3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for E2F3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for E2F3 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used E2F3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • A good antibody to detect endogenous E2F3
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Brain (cortex) tissue
    Species: Mouse
    Verified Customer | Posted 02/03/2025
    E2F3 detection in mouse cortex sample
    1:2000 dilution at 4 degrees overnight to detect endogenous E2F3 from mouse cortex samples (10 ug).
    E2F3 Antibody - BSA Free NBP1-80295

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...