eIF2 alpha/EIF2S1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57470

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF2S1(eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa) The peptide sequence was selected from the N terminal of EIF2S1 (NP_004085). Peptide sequence VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for eIF2 alpha/EIF2S1 Antibody - BSA Free

Western Blot: eIF2 alpha/EIF2S1 Antibody [NBP1-57470]

Western Blot: eIF2 alpha/EIF2S1 Antibody [NBP1-57470]

Western Blot: eIF2 alpha/EIF2S1 Antibody [NBP1-57470] - Human Small Intestine, concentration 0.2-1 ug/ml.

Applications for eIF2 alpha/EIF2S1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF2 alpha

EIF2S1, also known as eIF2a, is the alpha subunit of the translation initiation factor eIF2 complex which catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. The phosphorylation state of eIF2S1 controls the rate of tRNA translation. When eIF2a is not phosphorylated, translation occurs at a normal rate. However, upon phosphorylation by one of several kinases, eIF2S1 is stabilized, thus preventing the GDP/GTP exchange reaction and slowing translation. Recombinant human EIF2S1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Long Name

Eukaryotic Translation Initiation Factor 2 Alpha

Alternate Names

EIF2S1

Entrez Gene IDs

1965 (Human)

Gene Symbol

EIF2S1

UniProt

Additional eIF2 alpha Products

Product Documents for eIF2 alpha/EIF2S1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for eIF2 alpha/EIF2S1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for eIF2 alpha/EIF2S1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF2 alpha/EIF2S1 Antibody - BSA Free and earn rewards!

Have you used eIF2 alpha/EIF2S1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for eIF2 alpha/EIF2S1 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: One of our customer is interested in testing NBP1-57470 in yeast. Do you have any data supporting this antibody works in yeast? If not it is possible to have a special discount with exchange of customer's results on the yeasts.

    A:

    We have not tested NBP1-57470 in yeast samples, and don't have any data to indicate whether it will work or not. We do have an Innovators Reward Program for customers who are interested in testing our products in new species or applications.

  • Q: Should this antibody be stored at -20C lyophilized or do I suspend first and then store at -20C?

    A: We recommend that this antibody be stored at -20C in both lyophilized and reconstituted forms. Once reconstituted aliquot the antibody into smaller quantities to avoid freeze-thaw cycles and store at -20C.

  • Q: One of our customer is interested in testing NBP1-57470 in yeast. Do you have any data supporting this antibody works in yeast? If not it is possible to have a special discount with exchange of customer's results on the yeasts.

    A:

    We have not tested NBP1-57470 in yeast samples, and don't have any data to indicate whether it will work or not. We do have an Innovators Reward Program for customers who are interested in testing our products in new species or applications.

  • Q: Should this antibody be stored at -20C lyophilized or do I suspend first and then store at -20C?

    A: We recommend that this antibody be stored at -20C in both lyophilized and reconstituted forms. Once reconstituted aliquot the antibody into smaller quantities to avoid freeze-thaw cycles and store at -20C.

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...