eIF3X Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87345

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human eIF3X. Peptide sequence: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for eIF3X Antibody - BSA Free

Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target: CLUH. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 3ug/ml
Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: CLUH. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345]

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: KIAA0664. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml
Immunoprecipitation: eIF3X Antibody [NBP2-87345]

Immunoprecipitation: eIF3X Antibody [NBP2-87345]

Immunoprecipitation: eIF3X Antibody [NBP2-87345] - KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP2-87345 with 1:200 dilution. Western blot was performed using NBP2-87345 at 1/1000 dilution.. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIAA0664 IP

Applications for eIF3X Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: eIF3X

eIF3X (putative eukaryotic translation initiation factor 3 subunit) belongs to the eIF-3 p135 family of evolutionarily conserved eIF-3 135kDa subunits found in yeast, nematode, slime mold, and human cells. In yeast, eIF3 p135 is not part of the core eIF-3 complex, but is proposed to be a probable component with unknown function

Alternate Names

CLU1, DKFZp686L05242, DKFZp686M09233, FLJ23672, hypothetical protein LOC23277, KIAA0664

Gene Symbol

CLUH

Additional eIF3X Products

Product Documents for eIF3X Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for eIF3X Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for eIF3X Antibody - BSA Free

There are currently no reviews for this product. Be the first to review eIF3X Antibody - BSA Free and earn rewards!

Have you used eIF3X Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...