eIF3X Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87345
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human eIF3X. Peptide sequence: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for eIF3X Antibody - BSA Free
Western Blot: eIF3X Antibody [NBP2-87345]
Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target: CLUH. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 3ug/mlWestern Blot: eIF3X Antibody [NBP2-87345]
Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: CLUH. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/mlWestern Blot: eIF3X Antibody [NBP2-87345]
Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: KIAA0664. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/mlImmunoprecipitation: eIF3X Antibody [NBP2-87345]
Immunoprecipitation: eIF3X Antibody [NBP2-87345] - KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP2-87345 with 1:200 dilution. Western blot was performed using NBP2-87345 at 1/1000 dilution.. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIAA0664 IPApplications for eIF3X Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: eIF3X
Alternate Names
CLU1, DKFZp686L05242, DKFZp686M09233, FLJ23672, hypothetical protein LOC23277, KIAA0664
Gene Symbol
CLUH
Additional eIF3X Products
Product Documents for eIF3X Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for eIF3X Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for eIF3X Antibody - BSA Free
There are currently no reviews for this product. Be the first to review eIF3X Antibody - BSA Free and earn rewards!
Have you used eIF3X Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- Immunoprecipitation Protocol
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...