EIF4A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57342

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF4A3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EIF4A3 Antibody - BSA Free

Western Blot: EIF4A3 Antibody [NBP1-57342]

Western Blot: EIF4A3 Antibody [NBP1-57342]

Western Blot: EIF4A3 Antibody [NBP1-57342] - HepG2 cell lysate, concentration 1.25ug/ml.

Applications for EIF4A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF4A3

DDX48 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.

Alternate Names

ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, EIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34

Gene Symbol

EIF4A3

UniProt

P38919 (Human)

Additional EIF4A3 Products

Product Documents for EIF4A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF4A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF4A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF4A3 Antibody - BSA Free and earn rewards!

Have you used EIF4A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies