ELK4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69129

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ELK4 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ELK4 (ELK4, ETS-domain protein (SRF accessory protein 1)) The peptide sequence was selected from the C terminal of ELK4. Peptide sequence ASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ELK4 Antibody - BSA Free

Western Blot: ELK4 Antibody [NBP1-69129]

Western Blot: ELK4 Antibody [NBP1-69129]

Western Blot: ELK4 Antibody [NBP1-69129] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Applications for ELK4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELK4

The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8.

Alternate Names

ELK4, ETS-domain protein (SRF accessory protein 1), ETS-domain protein, SAP-1, SAP1ETS domain-containing protein Elk-4, Serum response factor accessory protein 1, SRF accessory protein 1

Gene Symbol

ELK4

Additional ELK4 Products

Product Documents for ELK4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ELK4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ELK4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ELK4 Antibody - BSA Free and earn rewards!

Have you used ELK4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies