ELOVL5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59539
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to ELOVL5(ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)) The peptide sequence was selected from the N terminal of ELOVL5.
Peptide sequence EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for ELOVL5 Antibody - BSA Free
Western Blot: ELOVL5 Antibody [NBP1-59539]
Western Blot: ELOVL5 Antibody [NBP1-59539] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/mlWestern Blot: ELOVL5 Antibody [NBP1-59539]
Western Blot: ELOVL5 Antibody [NBP1-59539] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.Western Blot: ELOVL5 Antibody [NBP1-59539]
Western Blot: ELOVL5 Antibody [NBP1-59539] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.Western Blot: ELOVL5 Antibody [NBP1-59539]
Western Blot: ELOVL5 Antibody [NBP1-59539] - Jurkat, Antibody Dilution: 1.0 ug/ml ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.Western Blot: ELOVL5 Antibody [NBP1-59539]
Western Blot: ELOVL5 Antibody [NBP1-59539] - MCF7, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7.Applications for ELOVL5 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ELOVL5
Alternate Names
dJ483K16.1, EC 2.3.1.n8, elongation of very long chain fatty acids protein 5, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, ELOVL2,3-keto acyl-CoA synthase ELOVL5, Fatty acid elongase 1, hELO1, HELO1homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, homolog of yeast long chain polyunsaturated fatty acid elongatio, SUR4/Elo3-like, yeast)
Gene Symbol
ELOVL5
UniProt
Additional ELOVL5 Products
Product Documents for ELOVL5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ELOVL5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ELOVL5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ELOVL5 Antibody - BSA Free and earn rewards!
Have you used ELOVL5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...