EPB41L3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84857

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human E41L3. Peptide sequence: MTTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EPB41L3 Antibody - BSA Free

Western Blot: EPB41L3 Antibody [NBP2-84857]

Western Blot: EPB41L3 Antibody [NBP2-84857]

Western Blot: EPB41L3 Antibody [NBP2-84857] - Host: Rabbit. Target Name: E41L3. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for EPB41L3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EPB41L3

Band 4.1-like protein 3 (EPB41L3) is a critical growth regulator in the pathogenesis of meningiomas. EPB41L3 is highly Expressed in the brain, with lower levels found in the kidneys, intestines, and testis.

EPB41L3 is a member of a family of similar proteins whose expression is frequently lost in a variety of human tumors, including meningiomas, non-small-cell lung cancers, and breast carcinomas. It is also frequently down-regulated in human clinical prostate cancer. Studies have shown that Protein 4.1B normally triggers death in metastatic cells, thereby preventing cancer from spreading. A clinical test for Protein 4.1B activity could be useful in assessing the metastatic potential of prostate cancers. Therefore, EPB41L3 antibodies may be very useful for cancer research.

Alternate Names

4.1BFLJ37633, DAL1DAL-1,, Differentially expressed in adenocarcinoma of the lung protein 1, erythrocyte membrane protein band 4.1-like 3, KIAA0987band 4.1-like protein 3

Gene Symbol

EPB41L3

Additional EPB41L3 Products

Product Documents for EPB41L3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EPB41L3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EPB41L3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EPB41L3 Antibody - BSA Free and earn rewards!

Have you used EPB41L3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...