EPS8L1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56615

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to EPS8L1(EPS8-like 1) The peptide sequence was selected from the middle region of EPS8L1. Peptide sequence LQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EPS8L1 Antibody - BSA Free

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.
Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615]

Western Blot: EPS8L1 Antibody [NBP1-56615] - Jurkat, Antibody Dilution: 1.0 ug/ml There is BioGPS gene expression data showing that EPS8L1 is expressed in Jurkat.

Applications for EPS8L1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EPS8L1

EPS8L1 a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. At least two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Alternate Names

DRC3EPS8R1, epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1, EPS8-like 1, EPS8-like protein 1, EPS8-related protein 1, FLJ20258, MGC23164, MGC4642

Gene Symbol

EPS8L1

UniProt

Additional EPS8L1 Products

Product Documents for EPS8L1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EPS8L1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EPS8L1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EPS8L1 Antibody - BSA Free and earn rewards!

Have you used EPS8L1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...