FMO1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87453

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all FMO1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of FMO1. Peptide sequence: LWRFTEHVEEGRASLYNSVVSNSSKEMSCYSDFPFPEDYPNFVPNSLFLE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FMO1 Antibody - BSA Free

Western Blot: FMO1 Antibody [NBP2-87453]

Western Blot: FMO1 Antibody [NBP2-87453]

Western Blot: FMO1 Antibody [NBP2-87453] - WB Suggested Anti-Fmo1 Antibody. Titration: 1.0 ug/ml. Positive Control: Rat Muscle

Applications for FMO1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FMO1

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase andis subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidationcapacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenasesare NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs,pesticides, and xenobiotics. (provided by RefSeq)

Alternate Names

dimethylaniline monooxygenase [N-oxide-forming] 1, Dimethylaniline oxidase 1, EC 1.14.13.8, Fetal hepatic flavin-containing monooxygenase 1, flavin containing monooxygenase 1, Flavin-containing monooxygenase 1 (fetal liver), FMO 1

Gene Symbol

FMO1

Additional FMO1 Products

Product Documents for FMO1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FMO1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FMO1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FMO1 Antibody - BSA Free and earn rewards!

Have you used FMO1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies