G gamma4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84035

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all G gamma4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human G gamma4. Peptide sequence: EACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPASENPFREKKFFCTIL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for G gamma4 Antibody - BSA Free

Western Blot: G gamma4 Antibody [NBP2-84035]

Western Blot: G gamma4 Antibody [NBP2-84035]

Western Blot: G gamma4 Antibody [NBP2-84035] - Host: Rabbit. Target Name: GNG4. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for G gamma4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G gamma4

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in varioustransmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement ofGDP by GTP, and for G protein-effector interaction

Alternate Names

DKFZp547K1018, FLJ23803, FLJ34187, GNGT4, guanine nucleotide binding protein (G protein), gamma 4, guanine nucleotide binding protein 4, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4

Gene Symbol

GNG4

Additional G gamma4 Products

Product Documents for G gamma4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G gamma4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for G gamma4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G gamma4 Antibody - BSA Free and earn rewards!

Have you used G gamma4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies