G protein alpha Inhibitor 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58301

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GNAI2(guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2) The peptide sequence was selected from the C terminal of GNAI2 (NP_002061). Peptide sequence EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha-2.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for G protein alpha Inhibitor 2 Antibody - BSA Free

Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301]

Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301]

Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301]

Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301]

Western Blot: G protein alpha Inhibitor 2 Antibody [NBP1-58301] - GNAI2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung

Applications for G protein alpha Inhibitor 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: G protein alpha Inhibitor 2

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Alternate Names

alpha-2 subunit, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 2

Entrez Gene IDs

2771 (Human)

Gene Symbol

GNAI2

UniProt

Additional G protein alpha Inhibitor 2 Products

Product Documents for G protein alpha Inhibitor 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for G protein alpha Inhibitor 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for G protein alpha Inhibitor 2 Antibody - BSA Free

Customer Reviews for G protein alpha Inhibitor 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review G protein alpha Inhibitor 2 Antibody - BSA Free and earn rewards!

Have you used G protein alpha Inhibitor 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...