G6PC Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80533
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Human, Mouse
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI. The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Human reactivity reported in scientific literature (PMID: 24755741).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for G6PC Antibody - BSA Free
Western Blot: G6PC Antibody [NBP1-80533]
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/mlWestern Blot: G6PC Antibody [NBP1-80533]
Western Blot: G6PC Antibody [NBP1-80533] - Mouse Intestine, concentration 1 ug/ml.Western Blot: G6PC Antibody [NBP1-80533]
Western Blot: G6PC Antibody [NBP1-80533] - Sample Tissue: Mouse Lung Antibody Dilution: 1.0ug/mlWestern Blot: G6PC Antibody [NBP1-80533]
Western Blot: G6PC Antibody [NBP1-80533] - Host: Rabbit. Target Name: G6PC. Sample Tissue: Mouse Liver. Antibody Dilution: 1ug/mlWestern Blot: G6PC Antibody - BSA Free [NBP1-80533] -
5-Aminoimidazole-4-carboxamide1-b-D-ribofuranoside (AIACR) and compound C could regulate the AMPK signalling pathway under empagliflozin treatment in vitro. HL7702 cells were treated with the AMPK agonist AICAR and empagliflozin and PA. (A) Glucose production levels (n = 3 samples/group). (B) PEPCK and G6Pase activities (n = 3 samples/group). (C) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (D) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA vs. PA+AIACR. HL7702 cells were treated with the AMPK inhibitor compound C and empagliflozin and PA. (E) Glucose production levels (n = 3 samples/group). (F) PEPCK and G6Pase activities (n = 3 samples/group). (G) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (H) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA+Empa vs. PA+Empa+Compound C. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35299662), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: G6PC Antibody - BSA Free [NBP1-80533] -
5-Aminoimidazole-4-carboxamide1-b-D-ribofuranoside (AIACR) and compound C could regulate the AMPK signalling pathway under empagliflozin treatment in vitro. HL7702 cells were treated with the AMPK agonist AICAR and empagliflozin and PA. (A) Glucose production levels (n = 3 samples/group). (B) PEPCK and G6Pase activities (n = 3 samples/group). (C) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (D) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA vs. PA+AIACR. HL7702 cells were treated with the AMPK inhibitor compound C and empagliflozin and PA. (E) Glucose production levels (n = 3 samples/group). (F) PEPCK and G6Pase activities (n = 3 samples/group). (G) Relative protein expression levels of p-AMPK, AMPK, p-GSK3 beta, GSK3 beta, p-CREB, CREB, PEPCK, and G6PASE were determined by western blotting. (H) Protein quantitative statistics (n = 3 samples/group). *P < 0.05, PA vs. PA+Empa; #P < 0.05, PA+Empa vs. PA+Empa+Compound C. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35299662), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for G6PC Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Reviewed Applications
Read 1 review rated 4 using NBP1-80533 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: G6PC
Alternate Names
EC 3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha, G6PT, glucose-6-phosphatase, Glucose-6-phosphatase alpha, glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease), glucose-6-phosphatase, catalytic subunit, GSD1, GSD1a, MGC163350
Gene Symbol
G6PC1
UniProt
Additional G6PC Products
Product Documents for G6PC Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for G6PC Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for G6PC Antibody - BSA Free
Customer Reviews for G6PC Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used G6PC Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: mouse liverSpecies: MouseVerified Customer | Posted 10/15/2018Mouse liver samples, 1:500 dilution
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...