GAT3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91920
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for GAT3 Antibody - BSA Free
Western Blot: GAT3 Antibody [NBP1-91920]
Western Blot: GAT3 Antibody [NBP1-91920] - Analysis in human cerebral cortex tissue.Immunohistochemistry: GAT3 Antibody - BSA Free [NBP1-91920]
Staining of human Liver shows no positivity in hepatocytes as expected.Western Blot: GAT3 Antibody - BSA Free [NBP1-91920]
Analysis in human cerebral cortex tissue.Western Blot: GAT3 Antibody - BSA Free [NBP1-91920] -
Glutamate and GABA transporter levels in the synaptosomal fraction. (A) Representative western blots of glutamate and GABA transporter protein expression in wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice. (B) Western blot quantification of the transporters (shown are n=3 independent samples). HTT was probed to confirm the genotype of sample mice on the same blot probed for GAT1 (same beta -actin loading control as shown for GAT1). No significant difference was observed in GLT1, GAT3 and GAT1 (n=5-6/genotype). Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: GAT3 Antibody - BSA Free [NBP1-91920] -
Expression of neurotransmitter transporters. (A,B) Representative RNAscope images of Slc6a1, Slc6a11and Gja1 in the striatum. Scale bars: 50 μm. The numbers of Gja1-positive cells co-labeled with Slc6a1 (encoding GAT1) or Slc6a11 (encoding GAT3) were counted. (C) Representative western blots of GLT1, GAT3 and GAT1 protein expression in the striatum of wild-type, wild-type/dnSNARE, BACHD and BACHD/dnSNARE mice (each lane represents a single sample; each sample is pooled from three mice of the same genotype). (D) Western blot quantification of GLT1, GAT3 and GAT1 (n=6/genotype). WT, wild type. The loading control beta -actin shown for GAT1 in C is the same as the beta -actin shown for Cx43 in Fig. 5A. The same membrane was probed for beta -actin, GAT1 and Cx43. The loading control beta -actin shown for GLT1 in C is the same as the beta -actin used for GFAP in Fig. 5A. GLT1 and GFAP were probed on the same blot membrane. Data are mean+/-s.e.m. Differences among the groups were assessed by one-way ANOVA followed by Tukey's HSD multiple comparison procedure. Non-significant P-values are not displayed on graphs. Refer to Table 1 for all P-values. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/39526491), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for GAT3 Antibody - BSA Free
Application
Recommended Usage
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GAT3
Long Name
Sodium- and chloride-dependent GABA transporter 3
Alternate Names
GABT3, GAT-3, SLC6A11
Gene Symbol
SLC6A11
Additional GAT3 Products
Product Documents for GAT3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GAT3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for GAT3 Antibody - BSA Free
Customer Reviews for GAT3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GAT3 Antibody - BSA Free and earn rewards!
Have you used GAT3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...