GATM Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54764

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GATM Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GATM(glycine amidinotransferase (L-arginine:glycine amidinotransferase)) The peptide sequence was selected from the middle region of GATM. Peptide sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GATM Antibody - BSA Free

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764] - Sample Type: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764]

Western Blot: GATM Antibody [NBP1-54764] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: 721_B cell lysate GATM is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Applications for GATM Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GATM

GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

AGATtransamidinase, AT, EC 2.1.4, EC 2.1.4.1, glycine amidinotransferase (L-arginine:glycine amidinotransferase), glycine amidinotransferase, mitochondrial, L-arginine:glycine amidinotransferase, Transamidinase

Gene Symbol

GATM

UniProt

P50440 (Human)

Additional GATM Products

Product Documents for GATM Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GATM Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GATM Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GATM Antibody - BSA Free and earn rewards!

Have you used GATM Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies