GBA2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84956

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GBA2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GBA2. Peptide sequence: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GBA2 Antibody - BSA Free

Western Blot: GBA2 Antibody [NBP2-84956]

Western Blot: GBA2 Antibody [NBP2-84956]

Western Blot: GBA2 Antibody [NBP2-84956] - Host: Rabbit. Target Name: GBA2. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for GBA2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GBA2

GBA2 encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous compounds. Studies to determine subcellular localization of this protein in the liver indicated that the enzyme was mainly enriched in the microsomal fraction where it appeared to be confined to the endoplasmic reticulum. This putative transmembrane protein is thought to play a role in carbohydrate transport and metabolism. [provided by RefSeq]

Alternate Names

AD035, Beta-glucocerebrosidase 2, Beta-glucosidase 2, bile acid beta-glucosidase, DKFZp762K054, glucosidase, beta (bile acid) 2, Glucosylceramidase 2, KIAA1605EC 3.2.1.45, MGC16895, NLGase, non-lysosomal glucosylceramidase

Gene Symbol

GBA2

Additional GBA2 Products

Product Documents for GBA2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GBA2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GBA2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GBA2 Antibody - BSA Free and earn rewards!

Have you used GBA2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies