GCAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54868

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GCAP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GCAP1 Antibody - BSA Free

Western Blot: GCAP1 Antibody [NBP1-54868]

Western Blot: GCAP1 Antibody [NBP1-54868]

Western Blot: GCAP1 Antibody [NBP1-54868] - Human kidney lysate, concentration 0.2-1 ug/ml.

Applications for GCAP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCAP1

GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia.

Alternate Names

C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1

Gene Symbol

GUCA1A

UniProt

P43080 (Human)

Additional GCAP1 Products

Product Documents for GCAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GCAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GCAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCAP1 Antibody - BSA Free and earn rewards!

Have you used GCAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies