GEMIN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80445

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GEMIN2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Sip1. Peptide sequence PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GEMIN2 Antibody - BSA Free

Western Blot: GEMIN2 Antibody [NBP1-80445]

Western Blot: GEMIN2 Antibody [NBP1-80445]

Western Blot: GEMIN2 Antibody [NBP1-80445] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

Applications for GEMIN2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GEMIN2

SIP1 encodes one of the proteins found in the SMN complex, which consists of the suvival of motor neuron protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration.

Alternate Names

Component of gems 2, gemin-2, GEMIN2survival of motor neuron protein-interacting protein 1, SIP1-delta, SMN interacting protein 1-delta, SMN-interacting protein 1, survival of motor neuron protein interacting protein 1

Gene Symbol

GEMIN2

UniProt

NP_079932 (Mouse)

Additional GEMIN2 Products

Product Documents for GEMIN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GEMIN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GEMIN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GEMIN2 Antibody - BSA Free and earn rewards!

Have you used GEMIN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies