GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79553

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human GFRA2. Peptide sequence NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFR alpha-2/GDNF R alpha-2

Members of the glial cell line derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuron survival and differentiation. Physiological responses to NTN require the presence of a novel glycosylphosphadidylinositol linked protein NTNRa, which is a cell surface receptor for NTN. The cDNAs encoding NTNRa from human, rat, chicken, and mouse have been cloned recently. NTNRa was also termed GDNFRb, Ret ligand 2 (RETL2) or TGFb related neurotrophic factor receptor 2 (TrnR2) and nominated as GFRa2 recently. GFRa2 binds NTN and mediates activation of RET receptor tyrosine kinase by both NTN and GDNF. Thus, NTN, GFRa2, and the Ret PTK form a complex to transduce NTN signal and to mediate NTN function.

Long Name

Glial Cell line-derived Neurotrophic Factor Receptor alpha 2

Alternate Names

GDNF R alpha-2, GFR alpha2, GFRa-2, GFRA2

Gene Symbol

GFRA2

Additional GFR alpha-2/GDNF R alpha-2 Products

Product Documents for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free and earn rewards!

Have you used GFR alpha-2/GDNF R alpha-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...