GJC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87499

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GJC3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJC3. Peptide sequence: WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GJC3 Antibody - BSA Free

Western Blot: GJC3 Antibody [NBP2-87499]

Western Blot: GJC3 Antibody [NBP2-87499]

Western Blot: GJC3 Antibody [NBP2-87499] - WB Suggested Anti-GJC3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysate

Applications for GJC3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GJC3

Connexins, such as GJC3, are involved in the formation of gap junctions, intercellular conduits that directly connectthe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of whichcontains 6 connexin subunits (Sohl et al., 2003 (PubMed 12881038)).(supplied by OMIM)

Alternate Names

connexin 29, Connexin-30.2, Connexin-31.3, CX29, Cx30.2, CX30.2connexin-31.3, CX31.3, Gap junction epsilon-1 protein, gap junction gamma-3 protein, gap junction protein, epsilon 1, 29kDa, gap junction protein, gamma 3, 30.2kDa, GJE1

Gene Symbol

GJC3

Additional GJC3 Products

Product Documents for GJC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GJC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GJC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GJC3 Antibody - BSA Free and earn rewards!

Have you used GJC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies