Glucuronic Acid Epimerase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87506

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Glucuronic Acid Epimerase Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Glucuronic Acid Epimerase. Peptide sequence: ETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Glucuronic Acid Epimerase Antibody - BSA Free

Western Blot: Glucuronic Acid Epimerase Antibody [NBP2-87506]

Western Blot: Glucuronic Acid Epimerase Antibody [NBP2-87506]

Western Blot: Glucuronic Acid Epimerase Antibody [NBP2-87506] - Host: Rabbit. Target Name: GLCE. Sample Tissue: 721_B lymphoblast Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Glucuronic Acid Epimerase Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glucuronic Acid Epimerase

Heparan sulfate (HS) is a negatively charged cell surface polysaccharide required for the biologic activities of circulating extracellular ligands. GLCE is responsible for epimerization of D-glucuronic acid (GlcA) to L-iduronic acid (IdoA) of HS, which endows the nascent polysaccharide chain with the ability to bind growth factors and cytokines (Ghiselli and Agrawal, 2005 [PubMed 15853773]).[supplied by OMIM]

Alternate Names

D-glucuronyl C5-epimerase, EC 5.1.3, EC 5.1.3.-, glucuronic acid epimerase, glucuronyl C5-epimerase, Heparin/heparan sulfate:glucuronic acid C5-epimerase, HSEPIheparin/heparan sulfate-glucuronic acid C5-epimerase, KIAA0836heparan sulfate epimerase, UDP-glucuronic acid epimerase

Gene Symbol

GLCE

Additional Glucuronic Acid Epimerase Products

Product Documents for Glucuronic Acid Epimerase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glucuronic Acid Epimerase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glucuronic Acid Epimerase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glucuronic Acid Epimerase Antibody - BSA Free and earn rewards!

Have you used Glucuronic Acid Epimerase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies