GNAI3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82234

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GNAI3. Peptide sequence: ESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GNAI3 Antibody - BSA Free

Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234] - Host: Rabbit. Target Name: GNAI3. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234] - WB Suggested Anti-GNAI3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain
Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234]

Western Blot: GNAI3 Antibody [NBP2-82234] - Host: Rabbit. Target Name: GNAI3. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml

Applications for GNAI3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNAI3

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in varioustransmembrane signaling systems. G(k) is the stimulatory G protein of receptor-regulated K(+) channels

Alternate Names

FLJ26559, G(i) alpha-3, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 3,87U6, guanine nucleotide-binding protein G(k) subunit alpha

Gene Symbol

GNAI3

Additional GNAI3 Products

Product Documents for GNAI3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GNAI3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNAI3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNAI3 Antibody - BSA Free and earn rewards!

Have you used GNAI3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...