GRF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58306

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRF2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RAPGEF1(Rap guanine nucleotide exchange factor (GEF) 1) The peptide sequence was selected from the C terminal of RAPGEF1 (NP_005303). Peptide sequence LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

121 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GRF2 Antibody - BSA Free

Western Blot: GRF2 Antibody [NBP1-58306]

Western Blot: GRF2 Antibody [NBP1-58306]

Western Blot: GRF2 Antibody [NBP1-58306] - Human Brain lysate, concentration 0.2-1 ug/ml.

Applications for GRF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRF2

RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Alternate Names

C3GGRF2guanine nucleotide-releasing factor 2 (specific for crk proto-oncogene), CRK SH3-binding GNRP, DKFZp781P1719, Guanine nucleotide-releasing factor 2, Protein C3G, Rap guanine nucleotide exchange factor (GEF) 1, rap guanine nucleotide exchange factor 1

Entrez Gene IDs

2889 (Human)

Gene Symbol

RAPGEF1

UniProt

Q13905 (Human)

Additional GRF2 Products

Product Documents for GRF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRF2 Antibody - BSA Free and earn rewards!

Have you used GRF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies