GRG (Groucho homolog) Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10933

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GRG (Groucho homolog) Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse GRG (Groucho homolog) (NP_034477). Peptide sequence QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GRG (Groucho homolog) Antibody - BSA Free

Western Blot: GRG (Groucho homolog) Antibody [NBP3-10933]

Western Blot: GRG (Groucho homolog) Antibody [NBP3-10933]

Western Blot: GRG (Groucho homolog) Antibody [NBP3-10933] - Western blot analysis of GRG (Groucho homolog) in Mouse Stomach as a positive control. Antibody dilution at 1.0 ug/ml

Applications for GRG (Groucho homolog) Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRG (Groucho homolog)

GRG (Groucho homolog) is encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.

Alternate Names

AES-1, AES-2, Amino enhancer of split, amino-terminal enhancer of split, ESP1, Gp130-associated protein GAM, GRG, GRG5, Protein ESP1, Protein GRG, TLE5

Gene Symbol

TLE5

Additional GRG (Groucho homolog) Products

Product Documents for GRG (Groucho homolog) Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRG (Groucho homolog) Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRG (Groucho homolog) Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRG (Groucho homolog) Antibody - BSA Free and earn rewards!

Have you used GRG (Groucho homolog) Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies