GRINL1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GRINL1A Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of GRINL1A. Peptide sequence: LQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYNPEGESSGRYREVRDEDD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GRINL1A Antibody - BSA Free

Western Blot: GRINL1A Antibody [NBP2-85016]

Western Blot: GRINL1A Antibody [NBP2-85016]

Western Blot: GRINL1A Antibody [NBP2-85016] - WB Suggested Anti-GRINL1A Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta

Applications for GRINL1A Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRINL1A

GRINL1A is part of a complex transcript unit that includes the gene for GRINL1A combined protein (Gcom1). Transcription of this gene occurs at a downstream promoter, with at least three different alternatively spliced variants, grouped together as Gdown for GRINL1A downstream transcripts. The Gcom1 gene uses an upstream promoter for transcription and also has multiple alternatively spliced variants. [provided by RefSeq]

Alternate Names

DKFZp586F1918, glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A, Glutamate receptor-like protein 1A, GRINL1A downstream protein Gdown4, protein GRINL1A, protein GRINL1A, isoforms 4/5

Gene Symbol

POLR2M

Additional GRINL1A Products

Product Documents for GRINL1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GRINL1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRINL1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRINL1A Antibody - BSA Free and earn rewards!

Have you used GRINL1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies