GSH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86662

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GSH2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GSH2. Peptide sequence: LLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GSH2 Antibody - BSA Free

Western Blot: GSH2 Antibody [NBP2-86662]

Western Blot: GSH2 Antibody [NBP2-86662]

Western Blot: GSH2 Antibody [NBP2-86662] - WB Suggested Anti-GSH2 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:62500. Positive Control: LN18 cell lysate

Applications for GSH2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSH2

The GSH2 (also known as GSX2) gene codes for a 304 amino acid long, 32 kDA GS homeobox 2 protein that is a transcription factor that binds to the DNA sequence 5'-CNAATTAG-3'. The GSH2 gene has been researched for its role in leukemia as well as neuronitis. Interactions between GSH2 and ABL1 and NKX2-1 are known to exist.

Alternate Names

GS homeobox 2, GSH2, Homeobox protein GSH-2

Gene Symbol

GSX2

Additional GSH2 Products

Product Documents for GSH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSH2 Antibody - BSA Free and earn rewards!

Have you used GSH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies