GSTZ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55137

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GSTZ1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GSTZ1(glutathione transferase zeta 1 (maleylacetoacetate isomerase)) The peptide sequence was selected from the N terminal of GSTZ1. Peptide sequence MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GSTZ1 Antibody - BSA Free

Western Blot: GSTZ1 Antibody [NBP1-55137]

Western Blot: GSTZ1 Antibody [NBP1-55137]

Western Blot: GSTZ1 Antibody [NBP1-55137] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.

Applications for GSTZ1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTZ1

GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms.

Alternate Names

EC 2.5.1.18, EC 5.2.1.2, glutathione S-alkyltransferase, glutathione S-aralkyltransferase, Glutathione S-transferase zeta 1, glutathione transferase zeta 1, GSTZ1-1maleylacetoacetate isomerase, MAAIglutathione S-aryltransferase, MAI, maleylacetone isomerase, MGC2029, S-(hydroxyalkyl)glutathione lyase

Gene Symbol

GSTZ1

UniProt

O43708 (Human)

Additional GSTZ1 Products

Product Documents for GSTZ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GSTZ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTZ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTZ1 Antibody - BSA Free and earn rewards!

Have you used GSTZ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies