GTF3C2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10918

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GTF3C2 (NP_001512). Peptide sequence YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

101 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GTF3C2 Antibody - BSA Free

Western Blot: GTF3C2 Antibody [NBP3-10918]

Western Blot: GTF3C2 Antibody [NBP3-10918]

Western Blot: GTF3C2 Antibody [NBP3-10918] - Western blot analysis using NBP3-10918 on r-GTF3C2 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for GTF3C2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF3C2

General transcription factor 3C polypeptide 2 (GTF3C2/TFIIIC110) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C2/TFIIIC110 to the TFIIIC complex has not been fully determined. TFIIIC that is not associated with GTF3C2/TFIIIC110 has been purified, and it has been proposed that GTF3C2/TFIIIC110 functions to activate the TFIIIC complex for RNA polymerase III transcription. Recent studies argue against this model of GTF3C2/TFIIIC110 function.

Alternate Names

general transcription factor 3C polypeptide 2, general transcription factor IIIC, polypeptide 2, beta 110kDa, KIAA0011general transcription factor IIIC, polypeptide 2 (beta subunit, 110kD), TF3C-beta, TFIIIC 110 kDa subunit, TFIIIC110Transcription factor IIIC 110 kDa subunit, TFIIIC-BETA, Transcription factor IIIC subunit beta

Gene Symbol

GTF3C2

Additional GTF3C2 Products

Product Documents for GTF3C2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTF3C2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF3C2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF3C2 Antibody - BSA Free and earn rewards!

Have you used GTF3C2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...