HAO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17862

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HAO2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HAO2 Antibody - BSA Free

Western Blot: HAO2 Antibody [NBP3-17862]

Western Blot: HAO2 Antibody [NBP3-17862]

Western Blot: HAO2 Antibody [NBP3-17862] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil

Applications for HAO2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAO2

HAO2 is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described. [provided by RefSeq]

Alternate Names

(S)-2-hydroxy-acid oxidase, peroxisomal, Cell growth-inhibiting gene 16 protein, EC 1.1.3.15, GIG16, growth-inhibiting protein 16, HAOX2glycolate oxidase, hydroxyacid oxidase 2, hydroxyacid oxidase 2 (long chain), Long chain alpha-hydroxy acid oxidase, Long-chain L-2-hydroxy acid oxidase

Gene Symbol

HAO2

Additional HAO2 Products

Product Documents for HAO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HAO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAO2 Antibody - BSA Free and earn rewards!

Have you used HAO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies