HARS2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85026

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of HARS2. Peptide sequence: AWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HARS2 Antibody - BSA Free

Western Blot: HARS2 Antibody [NBP2-85026]

Western Blot: HARS2 Antibody [NBP2-85026]

Western Blot: HARS2 Antibody [NBP2-85026] - WB Suggested Anti-HARS2 Antibody. Titration: 1.0 ug/ml. Positive Control: PANC1 Whole CellHARS2 is supported by BioGPS gene expression data to be expressed in PANC1

Applications for HARS2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HARS2

The HARS2 gene encodes a 506 amino acid, 56kDA probable histidine--tRNA ligase (mitochondrial) protein that is member to the II family of aminoacyl-tRNA synthetases which charge tRNA with cognate amino acids. The HARS2 gene is located in a head-to-head orientation with HARS on chromosome 5, which is the location of where homologous genes share a bidirectional promoter. The protein works as an accessory in the regulation of protein biosynthesis through the synthesis of histidyl-transfer RNA. HARS2 is involved in gene expression and mitochondrian tRNA aminoacylation and has been known to interact with genes ICT1, AARS2, AASS, ABSB7, and ACAD9. HARS2 has been investigated in immunodeficiency, malaria, pneumonia, hearing loss, tuberculosis, schizophrenia, and ovarian dysgenesis.

Alternate Names

EC 6.1.1, EC 6.1.1.21, HARSLprobable histidyl-tRNA synthetase, mitochondrial, HARS-related, HARSRhistidine tRNA ligase 2, mitochondrial (putative), hisRS, histidine translase, Histidine--tRNA ligase, Histidine--tRNA ligase-like, histidyl-tRNA synthetase 2, mitochondrial (putative), histidyl-tRNA synthetase-like, HO3histidine-tRNA ligase homolog

Gene Symbol

HARS2

Additional HARS2 Products

Product Documents for HARS2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HARS2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HARS2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HARS2 Antibody - BSA Free and earn rewards!

Have you used HARS2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...