HDJ2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87557

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human HDJ2. Peptide sequence: SPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HDJ2 Antibody - BSA Free

Western Blot: HDJ2 Antibody [NBP2-87557]

Western Blot: HDJ2 Antibody [NBP2-87557]

Western Blot: HDJ2 Antibody [NBP2-87557] - Host: Rabbit. Target Name: DNAJA1. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for HDJ2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HDJ2

HDJ 2 is a novel human homolog of E. coli's DNA J protein from heat shock protein 40 family. Hsp 40 is involved in chaperonic protein folding. HDJ-2 is cytoplasmic and nuclear membrane associated protein; upon heat shock it migrates and becomes associated with the golgi complex, nucleous and nuclear membrane. HDJ 2 has a prenylated C-terminus and is not inducible upon heat shock.

Alternate Names

DJ-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, HDJ2, hDj-2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7

Gene Symbol

DNAJA1

Additional HDJ2 Products

Product Documents for HDJ2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HDJ2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HDJ2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HDJ2 Antibody - BSA Free and earn rewards!

Have you used HDJ2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...