HE4/WFDC2 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-48762PEP

Novus Biologicals
Loading...

Key Product Details

Source

E. coli

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HE4/WFDC2.

Source: E. coli

Amino Acid Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48762.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-48762PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HE4/WFDC2

The HE4 gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members

Long Name

WAP Four-disulfide Core Domain protein 2

Alternate Names

EDDM4, WAP5, WFDC2

Gene Symbol

WFDC2

Additional HE4/WFDC2 Products

Product Documents for HE4/WFDC2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HE4/WFDC2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for HE4/WFDC2 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review HE4/WFDC2 Recombinant Protein Antigen and earn rewards!

Have you used HE4/WFDC2 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for HE4/WFDC2 Recombinant Protein Antigen

Showing  1 - 11 FAQ Showing All
  • Q: I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?

    A:

    At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here

Showing  1 - 11 FAQ Showing All
View all FAQs for Proteins and Enzymes
Loading...