HS6ST2 is a sulfotransferase that modifies HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in adhesion, migration, proliferation and differentiation, inflammation, blood coagulation, and other diverse processes.
Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87560
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2. Peptide sequence: ALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
Western Blot: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP2-87560]
Western Blot: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP2-87560] - Host: Rabbit. Target Name: H6ST2. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/mlApplications for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2
Alternate Names
EC-1
Gene Symbol
HS6ST2
Additional Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Products
- All Products for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2
- Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 ELISA Kits
- Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Lysates
- Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Primary Antibodies
- Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Proteins and Enzymes
Product Documents for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free and earn rewards!
Have you used Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...