hnRNP-R Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57158

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HNRNPR(heterogeneous nuclear ribonucleoprotein R) The peptide sequence was selected from the N terminal of HNRNPR. Peptide sequence ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for hnRNP-R Antibody - BSA Free

Western Blot: hnRNP-R Antibody [NBP1-57158]

Western Blot: hnRNP-R Antibody [NBP1-57158]

Western Blot: hnRNP-R Antibody [NBP1-57158] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: hnRNP-R Antibody [NBP1-57158]

Western Blot: hnRNP-R Antibody [NBP1-57158]

Western Blot: hnRNP-R Antibody [NBP1-57158] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate HNRNPR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Applications for hnRNP-R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP-R

HNRNPR belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has three repeats of quasi-RRM domains that bind to RNAs and also contains a nuclear localization motif. Multiple alternatively spliced transcript variants have been found for this gene. This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs and also contains a nuclear localization motif. Multiple alternatively spliced transcript variants have been found for this gene.

Alternate Names

FLJ25714, heterogeneous nuclear ribonucleoprotein R, hnRNP R, HNRPRhnRNP-R

Gene Symbol

HNRNPR

UniProt

Additional hnRNP-R Products

Product Documents for hnRNP-R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP-R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP-R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP-R Antibody - BSA Free and earn rewards!

Have you used hnRNP-R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for hnRNP-R Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking for an antibody to recognize mouse hnRNPR I see you have 2 that use almost identical immunogens but recognize proteins of different sizes? NBP1-89676 and NBP1-57158

    A: The differences you are seeing between the NBP1-89676 and NBP1-57158 are most likely due to the sample used in testing. For NBP1-89676, U-251MG and RT4 cell lysates were used in the testing, whereas for NBP1-57158, a 721_B cell lysate was used. It is very possible that these cell lines express different isoforms or different levels of each isoform. Unfortunately, I do not have any data as to which cell line expresses which isoform(s) of this protein.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...