HOXA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85008

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human HOXA3. Peptide sequence: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXA3 Antibody - BSA Free

Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008] - Host: Rabbit. Target Name: HOXA3. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008] - WB Suggested Anti-HOXA3 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008]

Western Blot: HOXA3 Antibody [NBP2-85008] - Host: Mouse. Target Name: HOXA3. Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml

Applications for HOXA3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA3

HOXA3 is 443 amino acids long, weighing approximately 46 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including teratocarcinoma, pharyngitis, esophagitis, and thyroiditis. HOXA3 has also been shown to have interactions with ALX4, PWP1, SOX10, SEC23B, and E2F4.

Alternate Names

homeo box A3, homeobox A3, Homeobox protein Hox-1E, homeobox protein Hox-A3, HOX1, Hox-1.5-like protein, HOX1Ehomeo box 1E, MGC10155

Gene Symbol

HOXA3

Additional HOXA3 Products

Product Documents for HOXA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA3 Antibody - BSA Free and earn rewards!

Have you used HOXA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...