HOXB8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83057

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HOXB8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXB8. Peptide sequence: FQNRRMKWKKENNKDKFPSSKCEQEELEKQKLERAPEAADEGDAQKGDKK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXB8 Antibody - BSA Free

Western Blot: HOXB8 Antibody [NBP2-83057]

Western Blot: HOXB8 Antibody [NBP2-83057]

Western Blot: HOXB8 Antibody [NBP2-83057] - WB Suggested Anti-HOXB8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Muscle

Applications for HOXB8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB8

HOXB8 is 243 amino acids long, weighing approximately 27.5 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including colorectal cancer, neuroblastoma, and neuronitis. HOXB8 has also been shown to have interactions with MEIS1, PBX2, PBX1, PBX3, and ASB1.

Alternate Names

homeo box 2D, homeo box B8, homeobox B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D, homeobox protein Hox-B8, HOX2, HOX2DHox-2.4

Gene Symbol

HOXB8

Additional HOXB8 Products

Product Documents for HOXB8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB8 Antibody - BSA Free and earn rewards!

Have you used HOXB8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies