HOXD4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-11018

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXD4 (NP_055436). Peptide sequence RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HOXD4 Antibody - BSA Free

Western Blot: HOXD4 Antibody [NBP3-11018]

Western Blot: HOXD4 Antibody [NBP3-11018]

Western Blot: HOXD4 Antibody [NBP3-11018] - Western blot analysis using NBP3-11018 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for HOXD4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXD4

HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq]

Alternate Names

HHO.C13, homeo box D4, homeobox D4, Homeobox protein HHO.C13, Homeobox protein Hox-4B, Homeobox protein Hox-5.1, homeobox protein Hox-D4, HOX4, Hox-4.2, Hox-4.2, mouse, homolog of homeo box X, HOX4BHOX-5.1

Gene Symbol

HOXD4

Additional HOXD4 Products

Product Documents for HOXD4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXD4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXD4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXD4 Antibody - BSA Free and earn rewards!

Have you used HOXD4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...