HOXD8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84077

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat HOXD8. Peptide sequence: TERQVKIWFQNRRMKWKKENNRDKFPASRPEAKDGDPKKEVSGLEEDGAE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXD8 Antibody - BSA Free

Western Blot: HOXD8 Antibody [NBP2-84077]

Western Blot: HOXD8 Antibody [NBP2-84077]

Western Blot: HOXD8 Antibody [NBP2-84077] - Host: Rabbit. Target Name: LOC100912020. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

Applications for HOXD8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXD8

HOXD8 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function.

Alternate Names

homeo box 4E, homeo box D8, homeobox D8, homeobox protein 5.4, Homeobox protein Hox-4E, Homeobox protein Hox-5.4, homeobox protein Hox-D8, HOX4, HOX4EHox-4.5, HOX5.4

Gene Symbol

HOXD8

Additional HOXD8 Products

Product Documents for HOXD8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXD8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXD8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXD8 Antibody - BSA Free and earn rewards!

Have you used HOXD8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...