HS3ST2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87601

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HS3ST2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HS3ST2. Peptide sequence: SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HS3ST2 Antibody - BSA Free

Western Blot: HS3ST2 Antibody [NBP2-87601]

Western Blot: HS3ST2 Antibody [NBP2-87601]

Western Blot: HS3ST2 Antibody [NBP2-87601] - Host: Rabbit. Target Name: HS3ST2. Sample Tissue: NCI-H226 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for HS3ST2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HS3ST2

HS3ST2 codes for a protein with a length of 367 amino acids and a weight of approximately 41.5 kDa, that is a sulfotransferase that utilizes PAPS and works to transfer a sulfo group to a glucosamine on heparan sulfate, without causing the heparan sulfate to being its anticoagulant form and is highly expressed in the brain with a lesser expression in the heart, lung and skeletal muscle. Current studies are being done on several diseases and disorders related to this gene including herpes simplex, chondrosarcoma, pancreatic cancer, colorectal cancer, pancreatitis, schizophrenia, and neuronitis. HS3ST2 has also been shown to have interactions with GLCE, GPC1, GPC2, GPC4, and GPC5 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteaux-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Alternate Names

EC 2.8.2, EC 2.8.2.29,3-OST-2, h3-OST-2, heparan sulfate (glucosamine) 3-O-sulfotransferase 2,30ST2,3OST2heparan sulfate glucosamine 3-O-sulfotransferase 2, Heparan sulfate 3-O-sulfotransferase 2, Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 2, heparin-glucosamine 3-O-sulfotransferase

Gene Symbol

HS3ST2

Additional HS3ST2 Products

Product Documents for HS3ST2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HS3ST2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HS3ST2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HS3ST2 Antibody - BSA Free and earn rewards!

Have you used HS3ST2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies