HSFY2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86671

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HSFY2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse HSFY2. Peptide sequence: SLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HSFY2 Antibody - BSA Free

Western Blot: HSFY2 Antibody [NBP2-86671]

Western Blot: HSFY2 Antibody [NBP2-86671]

Western Blot: HSFY2 Antibody [NBP2-86671] - Host: Rabbit. Target Name: Hsfy2. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for HSFY2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSFY2

HSFY2 encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Alternate Names

FLJ25453, Heat shock transcription factor 2-like protein, heat shock transcription factor, Y linked 2, heat shock transcription factor, Y-linked, HSF2L, HSF2-like, HSFY, HSFY1

Gene Symbol

HSFY2

Additional HSFY2 Products

Product Documents for HSFY2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HSFY2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSFY2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSFY2 Antibody - BSA Free and earn rewards!

Have you used HSFY2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies