Interleukin 4 induced protein 1 (IL-4I1), also known as protein FIG-1 and L-amino acid oxidase, is encoded by a B-cell IL-4-inducible gene, FIG1, and is highly expressed in primary metastinal B-cell lymphomas. It belongs to the flavin monoamine oxidase family, FIG1 subfamily. Enzymological characterization reveals that IL-4I1 has L-amino acid oxidase activity with preference toward aromatic amino acids. Studies have shown that hIL-4I1 inhibited the proliferation of CD3-stimulated T lymphocytes with a similar effect on CD4(+) and CD8(+) T cells. Its inhibitory effect was dependent on enzymatic activity and H2O2 production. Its restricted expression to lymphoid tissues indicates that it may play an important function in the immune system.
IL-4I1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-84089
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL-4I1. Peptide sequence: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Description
Novus Biologicals Rabbit IL-4I1 Antibody - BSA Free (NBP2-84089) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for IL-4I1 Antibody - BSA Free
Western Blot: IL-4I1 Antibody [NBP2-84089]
Western Blot: IL-4I1 Antibody [NBP2-84089] - WB Suggested Anti-IL4I1 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellWestern Blot: IL-4I1 Antibody [NBP2-84089]
Western Blot: IL-4I1 Antibody [NBP2-84089] - Host: Rabbit. Target: IL4I1. Positive control (+): RPMI-8226 (N12). Negative control (-): A549 (N03). Antibody concentration: 3ug/mlApplications for IL-4I1 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: IL-4I1
Long Name
Interleukin 4-induced Protein-1
Alternate Names
FIG1, IL4I1
Gene Symbol
IL4I1
Additional IL-4I1 Products
Product Documents for IL-4I1 Antibody - BSA Free
Product Specific Notices for IL-4I1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for IL-4I1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review IL-4I1 Antibody - BSA Free and earn rewards!
Have you used IL-4I1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...