IMMP2L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79838

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IMMP2L Antibody - BSA Free

Western Blot: IMMP2L Antibody [NBP1-79838]

Western Blot: IMMP2L Antibody [NBP1-79838]

Western Blot: IMMP2L Antibody [NBP1-79838] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Applications for IMMP2L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IMMP2L

IMMP2L is a gene that codes for a protein whose function is to catalyze the removal of transit peptides that are required in order to target protein from the mitochondrial matrix into the inter-membrane space in all tissues except the liver and lung. IMMP2L has a length of 175 amino acids and a weight of approximately 20 kDa, and it has a shorter isoform comprised of 110 amino acids with a weight of approximately 12 kDa. Current studies are being done on diseases and disorders related to this gene including Tourette syndrome and malaria. IMMP2L has also been shown to have interactions with ALDH1B1, GPX4, GUF1, HACL1, and IDO2 in pathways such as the protein export pathway.

Alternate Names

EC 3.4.21, EC 3.4.21.-, IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae), IMP2 inner mitochondrial membrane protease-like (S. cerevisiae), IMP2inner mitochondrial membrane peptidase 2 like, IMP2-LIKE, IMP2-like protein, mitochondrial inner membrane protease subunit 2

Gene Symbol

IMMP2L

Additional IMMP2L Products

Product Documents for IMMP2L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IMMP2L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IMMP2L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IMMP2L Antibody - BSA Free and earn rewards!

Have you used IMMP2L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...