Importin 11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09348

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Importin 11 (XP_226752). Peptide sequence VKNYAYKPSKNFEDSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLT

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Importin 11 Antibody - BSA Free

Western Blot: Importin 11 Antibody [NBP3-09348]

Western Blot: Importin 11 Antibody [NBP3-09348]

Western Blot: Importin 11 Antibody [NBP3-09348] - Western blot analysis of Importin 11 in Rat Pancreas lysates. Antibody dilution at 1.0ug/ml

Applications for Importin 11 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Importin 11

Principal Names: Importin-11 (IPO11); Imp11; Ran-binding protein 11 (RanBP11); Official Gene Symbol: IPO11 Gene ID: 51194 (Human) Gene Map Locus: 5q12.1 (Human) Importin-11 is a novel member of Karyopherin family. Karyopherins are transport receptors that mediate the transport of protein and RNA across the nucleus and cytoplasm. Importin-11 consists of an N-terminal Ran-binding domain, a central cargo-binding region and C-terminal region. It interacts with Ran-GTPase and constitutively shuttles between the nucleus and cytoplasm. Reports suggest Importin-11 primarily mediates the transport of ribosomal protein L12 and UbcM2, an E2 ubiquitin-conjugating enzyme.

Alternate Names

Imp11, importin 11, Ran binding protein 11, Ran-binding protein 11, RANBP11, RanBP11importin-11, SLRN

Gene Symbol

IPO11

Additional Importin 11 Products

Product Documents for Importin 11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Importin 11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Importin 11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Importin 11 Antibody - BSA Free and earn rewards!

Have you used Importin 11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...