INCA Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74090

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all INCA Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the middle region of CARD17. Immunizing peptide sequence MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for INCA Antibody - BSA Free

Western Blot: INCA Antibody [NBP1-74090]

Western Blot: INCA Antibody [NBP1-74090]

Western Blot: INCA Antibody [NBP1-74090] - Jurkat Cell Lysate, Antibody Titration: 1 ug/ml, and Gel concentration: 10-20%

Applications for INCA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INCA

As a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.

Alternate Names

caspase recruitment domain family, member 17, caspase recruitment domain-containing protein 17, Caspase-1 inhibitor INCA, INCAInhibitory CARD, inhibitory caspase recruitment domain (CARD) protein, Inhibitory caspase recruitment domain protein

Gene Symbol

CARD17P

UniProt

Q5XLA6 (Human)

Additional INCA Products

Product Documents for INCA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INCA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INCA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INCA Antibody - BSA Free and earn rewards!

Have you used INCA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies