Intersectin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86680

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Intersectin 2. Peptide sequence: TFTEGEEILVTQKDGEWWTGSIGDRSGIFPSNYVKPKDQESFGSASKSGA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Intersectin 2 Antibody - BSA Free

Western Blot: Intersectin 2 Antibody [NBP2-86680]

Western Blot: Intersectin 2 Antibody [NBP2-86680]

Western Blot: Intersectin 2 Antibody [NBP2-86680] - WB Suggested Anti-ITSN2 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for Intersectin 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Intersectin 2

Intersectin-2 is a cytoplasmic adapter protein that may provide a link between the actin assembly machinery and the endocytic membrance traffic, as well a control the production of clathrin-coated vesicles in terms of their invagination of budding. Intersectin-2 has four isoforms, with lengths of 1697, 1670, 1249, and 1192 amino acids and weights of 193, 190, 141, and 135 kDa respectively. Studies have been conducted on diseases and disorders related to this protein including Wiskott-Aldrich syndrome, dermatitis, sarcoma, schizophrenia, spasticity, pancreatitis, and pancreatic cancer. Intersectin-2 has also been known to have interactions with BCCIP, PTN, TBL3, MAP4K3, and SEMA6A in pathways such as the regulation of CDC42 activity pathway.

Alternate Names

intersectin 2, KIAA1256SH3 domain-containing protein 1B, PRO2015, SH3 domain protein 1B, SH3P18-like WASP associated protein, SH3P18SH3D1Bintersectin-2, SWA, SWAPSH3P18-like WASP-associated protein

Gene Symbol

ITSN2

Additional Intersectin 2 Products

Product Documents for Intersectin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Intersectin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Intersectin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Intersectin 2 Antibody - BSA Free and earn rewards!

Have you used Intersectin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...