IP6K3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85097

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IP6K3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human IP6K3. Peptide sequence: SPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IP6K3 Antibody - BSA Free

Western Blot: IP6K3 Antibody [NBP2-85097]

Western Blot: IP6K3 Antibody [NBP2-85097]

Western Blot: IP6K3 Antibody [NBP2-85097] - Host: Rabbit. Target Name: IP6K3. Sample Tissue: Human Liver Tumor lysates. Antibody Dilution: 1ug/ml

Applications for IP6K3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IP6K3

IP6K3, also known as Inositol hexakisphosphate kinase 3, is a 46 kDa 410 amino acid protein, and is involved in the transformation of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate. This protein has also been shown to have interactions with HIST1H2BC, HIST1H2BE, HIST1H2BF, HIST1H2BG, and HIST1H2BI in the inositol pyrophosphates biosynthesis and metabolism pathway. Disease research is currently being studied with relation to IP6K3 and lupus erythematosus and malaria.

Alternate Names

IHPK3ATP:1D-myo-inositol-hexakisphosphate phosphotransferase, inositol hexakisphosphate kinase 3, Inositol hexaphosphate kinase 3EC 2.7.4.21, InsP6 kinase 3, INSP6K3MGC102928

Gene Symbol

IP6K3

Additional IP6K3 Products

Product Documents for IP6K3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IP6K3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IP6K3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IP6K3 Antibody - BSA Free and earn rewards!

Have you used IP6K3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies