IQSEC2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84099

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IQSEC2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human IQSEC2. Peptide sequence: ARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IQSEC2 Antibody - BSA Free

Western Blot: IQSEC2 Antibody [NBP2-84099]

Western Blot: IQSEC2 Antibody [NBP2-84099]

Western Blot: IQSEC2 Antibody [NBP2-84099] - Host: Rabbit. Target Name: IQSEC2. Sample Type: MDA-MB-435S Whole Cell lysates. Antibody Dilution: 1.0ug/mlIQSEC2 is supported by BioGPS gene expression data to be expressed in MDA-MB435
Western Blot: IQSEC2 Antibody [NBP2-84099]

Western Blot: IQSEC2 Antibody [NBP2-84099]

Western Blot: IQSEC2 Antibody [NBP2-84099] - Host: Rabbit. Target: IQSEC2. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): HepG2 Cell Lysate (HG). Antibody concentration: 1ug/ml

Applications for IQSEC2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IQSEC2

Alternate Names

BRAG1, brefeldin A resistant Arf-guanine nucleotide exchange factor 1, brefeldin A resistant Arf-guanine nucleotide exchange factor 1c, IQ motif and Sec7 domain 2, IQ motif and SEC7 domain-containing protein 2, KIAA0522, MRX1

Gene Symbol

IQSEC2

Additional IQSEC2 Products

Product Documents for IQSEC2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IQSEC2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IQSEC2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IQSEC2 Antibody - BSA Free and earn rewards!

Have you used IQSEC2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies