KCNIP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84106

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all KCNIP4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP4. Peptide sequence: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for KCNIP4 Antibody - BSA Free

Western Blot: KCNIP4 Antibody [NBP2-84106]

Western Blot: KCNIP4 Antibody [NBP2-84106]

Western Blot: KCNIP4 Antibody [NBP2-84106] - WB Suggested Anti-KCNIP4 Antibody. Titration: 1.25 ug/ml. Positive Control: Jurkat Whole Cell

Applications for KCNIP4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KCNIP4

KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Alternate Names

A-type potassium channel modulatory protein 4, Calsenilin-like protein, KChIP4, KCHIP4CALPMGC44947, Kv channel interacting protein 4, Kv channel-interacting protein 4, potassium channel interacting protein 4, Potassium channel-interacting protein 4

Gene Symbol

KCNIP4

Additional KCNIP4 Products

Product Documents for KCNIP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KCNIP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KCNIP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KCNIP4 Antibody - BSA Free and earn rewards!

Have you used KCNIP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies